SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7F3T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7F3T4
Domain Number 1 Region: 1090-1107,1144-1252
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000039
Family Synaptotagmin-like (S variant) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7F3T4
Sequence length 1666
Comment (tr|E7F3T4|E7F3T4_DANRE) Coiled-coil and C2 domain-containing 2A {ECO:0000313|Ensembl:ENSDARP00000107405} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=cc2d2a OC=Cyprinidae; Danio.
Sequence
MSSPGDVREKIKKKRRELQESLGKVRDDKQALVPSDWDVSKENEHTAVEEMAGGKEDPGE
TLRHSLMARRMKKKKKLLKESAVECIADDEELTAVQDTRGADGQHARTPTELSPRDASPH
TVMRPGSSQSEKTMRQRMTEKLRAAKSKAASLLEQESSIEPVSRLQSLQDRNTVTRFDRD
MDPDLRADEDSSFAARLKFRDAARRAVKDKQVEAGLPTAEEAYNFFTFNFDPEPEQQRQK
KKRRSRRREAEEEEEGDSEGEVEGEDEEGEEVGELERQNEGEEESEARDEDDPLVGDEED
LFIIDQSAQDFLEVRRAEYVDYSRRLQRERDTLFVPSMRPVPASSKLAENTRPRFLEEEG
LYVGERPHVCLTNLNILENRILKQAEGRKWFGDDGRIVALPDPIKESSSRPPLFHLEDQL
DPALQTVYRKALKSKHVNLYIAGMGDHQADYQLDVDVSGLIFSHHPLFSREHVLGARLAQ
LYDQHLTRLHKNLTQLLTDKLNSLRNTIHNMLELHRGEALSQVSQQRIAEYKQEVRHTRQ
LRDVEQEKDRALLKNIIRLWKELKALRDFQRFTNTPYKLFIRREKVERLQDEQEFESDIM
AEVSELQAETEEEYQRKMNEYRRLHEEWKSWKRKQKALKKKQKKKRQEEEEEDEVSEEEL
GEEPEKPNPPEKPDTSILEEQVREKAARIRRNPGEPVLIPELTVSGSITANEQCPRAEFA
RREDVAKRSLFVKVLYNDKEVSRTDSRTLNMDFRVHFGQIFNLKIVNWPESIKLQVFESV
GSSSTQLTEVCVPVPESSVLTGSAPSEEMEFSSNQRVTFNHEGVGSGVPFSFEADGTNPQ
TLLTSGKLSCCVSWAVGEDDVPLAPPSAQPGVAMHSGLRQMDAIACIGASGLNDMKKLGK
WAAESRLDPNDPSNASIMQLLSVVSGGDMGVPEYFRLEQLQEEFNFLSEEELQRSRRYRL
LRLRSQEVQEFRHFKCVPSTDREISEKVFQDYENRLKEGEIIDTKEHIDAHRALVAKYLQ
RVRESVINRFLIAKHHFILSDVISEDEVPSIGVLGWNLFKLAEPKRPLKPRRKERKKVTA
QNLSEGDIKLLVNIIRGYDIPVRRPYTGKAPVSAKSGRSFTETFTAPASQTGQQGSEWPF
AQPLIRPFVEVSFQRSVLQTSTAEGPNPCWNEEIVLPFSAPNGDYSSTSLQSVRDEVFIN
VFDELLYDVVEDERERGNTIHTRIERHWLGSINIPFSTIYLQSRIDGTFKVCTPPVLLGY
SKERSLGSEGGYDAVRSPSEGTFLSLFITIEPQLVPGDTVREKFDSQEVERVLLASEVFE
KEASRRFSDRPCITTVIDINGKTVFVTRFIRPLNPPQELLDASPNGTQDSTELVARYVSL
IPSLPDSVSFAGVCDLWSTCDQFLTLLAGDEEEHAVLLCNYFLSMGKRAWLIIGSAIPEG
PTAYVLTYEQSRYVIWNASTGQHYGQYDVFCPLQTIGCLINADNVWFNIQPYAAPVRMSF
DISKPNLWKPFFSRAFPDPGLSSVQPDALVYRRTDRTAAVELQDRIEKVLREKLMEWRPR
HPTRWNRYCISTLRQFLPKLELSGGREVAEEHRLELQSLLGEYRISGFPLHLPFSELRPI
IEAVHSTGVHKVESPNVEFALAVYVHPYPSNVLSVWVYIASLVSAY
Download sequence
Identical sequences E7F3T4
ENSDARP00000107405 ENSDARP00000107405 XP_003201209.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]