SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7F725 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7F725
Domain Number 1 Region: 162-254
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.42e-22
Family Synaptotagmin-like (S variant) 0.0069
Further Details:      
 
Domain Number 2 Region: 23-147
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-21
Family PLC-like (P variant) 0.057
Further Details:      
 
Domain Number 3 Region: 304-507
Classification Level Classification E-value
Superfamily vWA-like 1.23e-20
Family Integrin A (or I) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7F725
Sequence length 559
Comment (tr|E7F725|E7F725_DANRE) Copine VII {ECO:0000313|Ensembl:ENSDARP00000141331} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=cpne7 OC=Cyprinidae; Danio.
Sequence
MSDSQEATSPVAGIGGPAACVCKVELRVSCKSLLDRDTLNKSDPCVILMVQNQGQWTELD
RTEVIKSNLNPVFAKVLMLDYYFEEVQKLRFEVYDIHGAHSIGTRDDDFLGGVECTLGQI
VAQKKMMKPLLLKYGKYAGKSTITIHAEEISGNNGYVELSFCAKKLDDKDLFSKSDPFLE
IYRINDDGTEQLVHRTEVIKNNLNPVWEPFKVSLISLCSCDDERKLKCLVWDYDSRGKHD
FIGEFYTNFKEMQKISSGNKVTWECINPKYKLKKKNYKNSGLVILSDLKLHRVYSFLDYI
MGGCQIHFTVAIDFTASNGDPRNSCSLHYINPYQPNEYLKALIAVGEICQDYDSDKRFSA
LGFGARIPPNYEVSHDFAINFNPEDDECEEIQGVVEAYQNCLPKIQLYGPTNVAPIINRI
AKQAAGKEPIKDASLYHILLILTDGVVTDMADTREAIVRASYQPMSIIIVGVGNADFTDM
QILDGDDGVLRSPKGEPVLRDIVQFVPFRDFKTASPAALAKCVLAEVPKQVVEYFSHKAI
PPMNPVLNSSPNSIANTPE
Download sequence
Identical sequences E7F725
XP_692981.4.45394 ENSDARP00000085485 ENSDARP00000085485 ENSDARP00000129215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]