SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7F7F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7F7F5
Domain Number 1 Region: 486-585
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.39e-38
Family MBT repeat 0.0000916
Further Details:      
 
Domain Number 2 Region: 404-526
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.43e-33
Family MBT repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 181-307
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.86e-28
Family MBT repeat 0.0009
Further Details:      
 
Domain Number 4 Region: 277-375
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.24e-22
Family MBT repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7F7F5
Sequence length 705
Comment (tr|E7F7F5|E7F7F5_DANRE) Mbt domain-containing 1 {ECO:0000313|Ensembl:ENSDARP00000080522} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=mbtd1 OC=Cyprinidae; Danio.
Sequence
MENPRDMAEHTPRSERKRRDSFGMFDGYDSCSEDSSSSSSSEDSEDEVPSIPASLPIIKN
NGQVYTYPDGKAGMATCEMCGMVGVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQG
KPPTKKAKVLQKQPLMAKLAAYAQYQASQQNQAKSKSVVPVEGFDWGQYICSNNLVGAPV
SCFKHVPMGMCWGDIAEGLRVEVFNSDTNLSTKVYWVAEIVKLAGFKALLRYEGFDNDSS
RDFWCNLCIPEIHPVGWCASSGKPLVPPKSIQHKYSNWKAFLVKRLTGAKTLPPEFATKV
QENMQYPFKKLMRVEVVDKTHLCRTRVALVEQVIGGRLRLVYEESQDGTDDFWCHMLSPL
IHSIGWSRSIGHRFKRSEVSKKIEGQMDAPSQLFLKIKDVDQNGDWFKDGMKLEAIDPLN
LSAICVATVRKVLADGYLMIGIDGSEAADGSDWFCYHSTSPSIFPVGFCEINSIELTPPR
GCTKLPFKWFDYLREIGSIAAPVKLFNKDVPNHGFRVGMKLEAVDLMEPRLVCVATVTRI
VHRLLRIHFDGWEDEYDQWVDCESPDLYPIGWCQLTGYQLQPPAAQTTREAPPNVSKQKK
KAAQYKGQKKKRKIPVGRRPIGLGGPLRRRSFSGDEEQTPPHYLSHFSGSRRPPASGVER
DRSLNSEASLQVKEETPEIDEFTFSQGISDQESNGSGSYYIRQEP
Download sequence
Identical sequences E7F7F5
ENSDARP00000080522 ENSDARP00000080522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]