SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7F8E2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7F8E2
Domain Number 1 Region: 183-254
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.97e-18
Family PHD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7F8E2
Sequence length 795
Comment (tr|E7F8E2|E7F8E2_DANRE) Jade family PHD finger 2 {ECO:0000313|Ensembl:ENSDARP00000069915} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=jade2 OC=Cyprinidae; Danio.
Sequence
MESEMKRRKYSTSSNDSDTTDSQVTTWSRSSKNTGTSSTWVRHEQKRPSEVFRTDFITAM
KLPDSAQLSADEFYILCDPWRQEWEKGVQVPANVETIPEPVVRMLPEVSRIPFFSAVQTR
SQSEISEPLSRYDLDDLDVAWLELVNAEFRQLALPELDELTMEQLLVELERRCQQNMQQQ
IENQEGLGIEYDEDVVCDVCRSPEGEDGNEMVFCDNCNVCVHQACYGILKVPQGNWLCRT
CALGVQSKCLLCPRRGGALKPTRSGTKWVHVSCALWIPEVSIGCPEKMEPITKVSHIPAS
RWALSCSLCCEHSGTCIQCSMPSCTVAFHVTCAFDHGLEMRTTLADNDEVRFKSYCLEHS
SVWRSNSSGGVQSDRPDPRHAVPDPAAAQKQEQAEREKASQRKQKLQELEDEFYTLVDPK
DIAESLSLPDAHVDFLFQYWKLRRKTNGNKPLVSMKRDEVDNLAQQEQDVLYRRLKLFTH
LRQDLERVRNLCCMITRREKIKHSLCNLQEKIFSLQIQLMEQNLVGEKSQRGERKHRNRV
QERVKERRKNSPEKKDKWRSDDNSLFSQLGFSRSFPIDGSLFDSWQAQSIHISAESMLSR
WSLSAGTPETSASLLSDQLLRGEESLLSLMMDSSMQNTWKTPRLGRKHPKSAPRSRRKTL
CSPPAKGKVCVTERRCRRGEKTEDFQRSSDGRSDPLQPAIAKMDSCHISEERDSVLEKRS
QKSVRMHLPRQSKTRCKSQTVESSVQSNTPDTETDGYFSDEEQSDGELRLFSRKSRMPQM
HAGKEEVVRRSLLAS
Download sequence
Identical sequences E7F8E2
XP_697831.5.45394 ENSDARP00000069915 ENSDARP00000069915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]