SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7F959 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7F959
Domain Number 1 Region: 492-770
Classification Level Classification E-value
Superfamily NHL repeat 2.09e-46
Family NHL repeat 0.0000146
Further Details:      
 
Domain Number 2 Region: 338-433
Classification Level Classification E-value
Superfamily E set domains 2.47e-20
Family Filamin repeat (rod domain) 0.0038
Further Details:      
 
Domain Number 3 Region: 117-178
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.7e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 22-92
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000773
Family RING finger domain, C3HC4 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7F959
Sequence length 772
Comment (tr|E7F959|E7F959_DANRE) Tripartite motif-containing 3b {ECO:0000313|Ensembl:ENSDARP00000101294} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=trim3b OC=Cyprinidae; Danio.
Sequence
MSVTMAKFETGRTSPVVRQIDKQFLVCSICLDHYHNPKVLPCLHTFCERCLQNYIPPQSL
TLSCPVCRQTSILPEKGVAALQNNFFITNLMEVLQRDSECSRPEACSVLESVSAAAAGKP
LSCPNHEGKVMEFYCESCETAMCLECTEGEHREHVTVPLRDVLEQHKAVLKNQLDAIRNR
LPQLTAAIEMVNEISKQLTERKNEAVNEINMTFEELERALHQRKAALITDLENICSTKQK
VLQAQLSSLLQGKEHIQSSCSFTEQALSHGSATEVLLVQKQMSERVSALACHDFPERPHE
NAHLDCQIETEGLRRSIQNLGVLLTTGAVGHTSVATGEGLRHALVGQHVTVTVTTKDKDS
ELVRTGNAALRAEIMGQDGAQVTEAEVVDNKNGTYEVGYTLKGEGEYLFSLILYGQPVRG
SPFKLRAIKPSDVPQSPDDVKRRVKSPSGTGGHIRQKAVRRPSSMYSTTKKKENPIEDEL
IYRVGTRGREKGEFTNLQGISASISGRVIVADSNNQCIQVFTNDGQFKARFGVRGRSPGQ
LQRPTGVAVDTNGDVIVADYDNRWISIFSPDGKFKNKIGAGRLMGPKGVAVDRNGHIIAV
DNKACCVFIFQSNGKLVTKFGARGTSDRQFAEKSGSKCALEQKFSKSGPGFSPHFVAVNN
KNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDVNGNIIVADWGNSR
IQVFDSAGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences E7F959
ENSDARP00000101294 XP_005155434.1.45394 XP_005155435.1.45394 XP_009303590.1.45394 XP_021334851.1.45394 ENSDARP00000101294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]