SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7F9B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7F9B3
Domain Number 1 Region: 395-592
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0031
Further Details:      
 
Domain Number 2 Region: 568-678
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.29e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7F9B3
Sequence length 711
Comment (tr|E7F9B3|E7F9B3_DANRE) TBC1 domain family, member 14 {ECO:0000313|Ensembl:ENSDARP00000040945} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:dkey-120m5.1 OC=Cyprinidae; Danio.
Sequence
MAEAEHSTNESNINTHNNDGPEVSSFSNSSLNQCLPISSKPLTQNNVDHHVPSDTQPPNV
SLSCKSFTSFNGTCEEDRSSLGSQDSGIPTLEINPPEHIHARVTIAELVVPPPHDDNPAT
LNLDISDGSLLKSSTFPRCDFDLVRHYGPSGLSSAAGKGTLNRSDDISVCSVSSLSTEFS
TTLSVSNEDFLDFMVTSESSAVVTFENEDVLHRFDSSLSAPIDLHGKLSSPQRQPVGVSG
AHEARPKRLGPLASFFNRGLFAKRMKDTGALEGQREPGWKLFGKVPHKDLPTKDSRKLQK
EYERRSGHTSNSTSPKKNVRKNLDFEPLSTTALILENRPANLPAKPEEEAQKHRQQYEEM
VAQAKKRELKDAQKRKKQLEDRCKLEESIGNAALTWSQEILPNWQSMCSSKRVRDLWWQG
LPPSVRGKVWSLAIGNELNITDELYDICLARAKEKWNAFVAPTAAVETESEDAGLSHADR
EASLELIKLDISRTFPNLCIFQKGGPYHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLIL
NLDTADAFIAFANLLNKPCQMAFYRVDHSLMLTYFAAFEVFFEENLPKLFAHFKNNNLSS
DIYLIDWIFTLYSKSLPLDIACRVWDVFCRDGEEFLFRTALGILRLYEDILTHMDFIHIA
QFLTRLPDYISAEEIFSSITTINMNSKNKKWPQVLQALQKGQDRGSPLLKR
Download sequence
Identical sequences E7F9B3
ENSDARP00000040945 ENSDARP00000040945 ENSDARP00000121985 XP_005166496.1.45394 XP_683181.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]