SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7F9N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7F9N1
Domain Number 1 Region: 173-369
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.56e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 2 Region: 345-454
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7F9N1
Sequence length 500
Comment (tr|E7F9N1|E7F9N1_DANRE) TBC1 domain family, member 12a {ECO:0000313|Ensembl:ENSDARP00000055755} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=tbc1d12a OC=Cyprinidae; Danio.
Sequence
GVRRQSAPDRVDVDPNASSDQTLGTKRHGIADFLTRSLFSWKPKESRAVASHSAPGWKLF
GKIQLRDNPLKDSRTIQQEYESRAGPATGPPLHPPPTRRKNLEFEPLSTTALILEDRPAN
LPAKSEEESQRHRQEYSEMVAGAKRREMKEAQKKKRQMKERYRQEENIASAMVIWNSEVL
PNWESMRNTRRVRDLWWQGVPPSVRGKVWCLAIGNELNITPELYEIFLSRAKEKWRSFSE
TSSVNENEDCGVSLADRESSLDLIKLDISRTFPSLYIFQKGGPYHDILHSVLGAYTCYRP
DVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQMAFFRVDHDLMLKYFAAFEVFFE
ENLPRLFQHFQNNSLTPDFYLIDWIFTLYSKSLPLDVACRVWDVFCRDGEEALFRTGLGI
LRLYQDVLLQMDFIHSAQFLSRLPENTPAHTLFSCIANTQMISNNRRWNQVFSTLIKDRL
KETDKISNSSSNSNSPALRS
Download sequence
Identical sequences E7F9N1
ENSDARP00000055755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]