SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7FA51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7FA51
Domain Number 1 Region: 120-291
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0062
Further Details:      
 
Domain Number 2 Region: 269-387
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.37e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7FA51
Sequence length 778
Comment (tr|E7FA51|E7FA51_DANRE) Ecotropic viral integration site 5b {ECO:0000313|Ensembl:ENSDARP00000106064} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=evi5b OC=Cyprinidae; Danio.
Sequence
MVATDKVTGKLSSTLSWVKNSVSHTVSQMASQVATPSSLHTTVASSTASLSSPSSASPTQ
LSPDDVELLAKLEEQNRLLETDSKSLRSVNGSRRNSGSSLVSSSSASSNLSHLEEDSWIL
WGRIVNEWEDVRKKKEKQLKELVRKGVPHHFRAIVWQLLCNAQNLPIKEQYSELLKMTSP
CEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQ
MPEEEAFCVFVKLMQEYRLRELFKPSMAELGLCMYQFECMIQEQLPELHVHFQAQSFHTS
MYASSWFLTIFLTSFPLPVATRIFDIFMCEGLEIVFRVGMAILQMNQAELMQLDMEGMLQ
HFQKVIPHQLDSGPDKVIQAAYQVKYNAKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENR
LLKQRIDTLEKKGNPRYTEESILQLERELVQARLKEAESQCALKEMQDKILYMEQRNTSL
PDENNVVRLQEELIGVKLREAEALTGLKELRQQVRDLEEHWQRHLARTAGRWKDSPRKNA
ASELQDELMSVRLREAEAQAELRETRQRMLELETQNQIHSNQLRRAELEARNLQDRLHVL
SNQNKMLHSELQETKRKQAEIECKNKEEVMAVRLREADNIAAMAELQQQISELEIQKEEG
KVQGQLNNTDSSQYIRDLKDQIADLKHEIRCLRGHQGLPNQHTFDGIHIVNHYGGDNESY
QSSDEDGVKLSPHLTTHQDRGRITLHPNLEDSESEGDEEGDALRLTVPSNVSHKTTTV
Download sequence
Identical sequences E7FA51
ENSDARP00000106064 XP_021332818.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]