SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7FB23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7FB23
Domain Number 1 Region: 617-799
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.41e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0017
Further Details:      
 
Domain Number 2 Region: 777-894
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.54e-25
Family Ypt/Rab-GAP domain of gyp1p 0.0063
Further Details:      
 
Domain Number 3 Region: 34-147
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Weak hits

Sequence:  E7FB23
Domain Number - Region: 470-531
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7FB23
Sequence length 946
Comment (tr|E7FB23|E7FB23_DANRE) TBC1 domain family, member 2B {ECO:0000313|Ensembl:ENSDARP00000083499} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=tbc1d2b OC=Cyprinidae; Danio.
Sequence
MQEEDESSANTSRNSRILTAKSFDVADCDGKKGQASKLCGYLNKLTGKGPLRGFKTRWFV
YDPRKCFLYYFKTPQDALPIGHIEIGDACFSYDVEAEEGLFEIHTEGKEFLLKAPNRQVM
RYWLQQLQQKRWEFCNMPGPRDSWCSPTPLYPHTGLVARDAEAMPYEKPSESMESVRNDF
ALELDNDGLIGHQTAHVPVAQPTAALSSLRQWGSEIRNSMSHLRPGRAGENRRSVFYTGG
SEDWEMVDPPTKDPAPSDCQHRESSSHFNRSSIGSAFTFDFRNPSKIKRPFHSGSGKPNH
SAESSPVEYNETKISKLQLRIQSQQEEISQLQEQENKLREELGSQKELVRLLQKTLRSAQ
CDWPSTVGPHNHYLEENEVDKALTERDTQIKDLCSHMEKLALEKESLQQELKGLKIKVGE
INEQLGMLMETIQAKDEVIMKLSQPSGEGETQSAECNSPSVTREQQELNTLKDSLQGYKS
QNKFLNKEIIELTVLRRNAESREKLLEAKYNSLEAKLCQVESKYLVLLQEVKSPVCSSSE
QTHSGDVITRLLEDALQVESTDQQEHPVLKPNAVSEYDIYGFKTVPEEEDEEEKLEAKKR
ALDLKSLSLTDQETSVRVKWDNYLAITMNREMVRSPDLKALMRGGVPHIHRSKVWSWCVS
FHVKKMRDCQPKDYYHNLLCMANDKPNPACKQIELDLLRTLPNNKHYSSPDSDGIQKLRN
VLLAFSWRNPDIGYCQGLNRLAAIALLYLDQEDAFWCLVAIVEVFMPHDYYTKTLLGSQV
DQRVFKDLMYEKLPRLHAHFEHYKVDFSLITFNWFLVVFVDSVVSDILFKIWDSFLYEGP
KIIFRFALALFKYKEEEFLKLQDPMTIFKYLRYFTRTILDARKLMAMAFVDMNPFPLRQI
QNRRTFHLEKVRLELTELEAIRQTFLRERESTMDGRTLISDDEEES
Download sequence
Identical sequences E7FB23
ENSDARP00000083499 ENSDARP00000083499 XP_002666912.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]