SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7FD53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7FD53
Domain Number 1 Region: 76-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000549
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 38-73
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000366
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7FD53
Sequence length 252
Comment (tr|E7FD53|E7FD53_DANRE) Si:dkey-178e17.3 {ECO:0000313|Ensembl:ENSDARP00000076004} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:dkey-178e17.3 OC=Cyprinidae; Danio.
Sequence
MSGAGVLWVCVLVVCVSAVCEAGCANRIDPTCCPGRNNDCSDRSFRRTVCYCDTYCRRSG
DCCEDYNTVCHVSAKDCEVTLWGAWSPCSSVCGAGTTERSRQVATPPRNGGTPCPDLKQR
RGCFAPTDTCSAAKEVAKILPDSFKRNFKDPWRRPHMLMKEEKKSYCVQMRVKQASAACK
VRPWSAGLIHERSVCVECQSDAMATDNRCRGDGLQNIRTFWAAAQAPGCSGSWVRESLTE
NCRCPSYSVIFV
Download sequence
Identical sequences E7FD53
ENSDARP00000076004 ENSDARP00000076004 XP_003199085.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]