SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7FE32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7FE32
Domain Number 1 Region: 344-537
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-54
Family Ypt/Rab-GAP domain of gyp1p 0.0026
Further Details:      
 
Domain Number 2 Region: 515-637
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-29
Family Ypt/Rab-GAP domain of gyp1p 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7FE32
Sequence length 717
Comment (tr|E7FE32|E7FE32_DANRE) TBC1 domain family, member 16 {ECO:0000313|Ensembl:ENSDARP00000122393} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=tbc1d16 OC=Cyprinidae; Danio.
Sequence
MSFGRLLRRASSKASDFLTFNVGTGGSRSVLDGEIIFSKNNVCVHPAEPLPGLPEHHPGY
LCVHLEKDETLGSTLILTWVPNSRIQRQDEEALRYITPESSPVRRNPRRRAHRSHSRPPA
APEEEEAADEEGQEPQNQALLEEGDEGSCELSADEVSRDSTIGSDSDTFSSPFCLSPVSE
ALGESSSSVFLDNESRECDEPMAHSASSASSLDSHAPSESSHSQGVRWEEQQNVMALEHL
CGVFRVDLGHMRSLRLFFSDEACTCGQLVIASRESQYKILHFHHAGLDKLAEVFQQWKCC
RETQLKDQVSDEKSCMQFSIRRPTLPSAEMHPEERLYRRLDVSSWLRHLNNSGQVLEEYK
LRKAIFFGGIDPSIRGEVWPFLLHYYSYDSTSEEREAWRLQKRGEYQDIQQRRLSMSPEE
HSEFWRKVQFTVDKDVVRTDRSNMFFRGENNPNVEIMRRILLNYAVFNPDMGYCQGMSDL
VAPLLTEIQDESDTFWCFVGLMENTIFISSPRDEDMERQLMYLRELLRLMLPRFHQHLTR
LGEDGLQLLFCHRWVLLCFKREFPDAEALRMWEACWAHYQTDYFHLFLCVAIIVLYGDDV
TEQQLATDQMLLHFSNLSMHMNGELVLRKARSLLYQFRLLPRIPCSLHDLCKLCGPGMWD
SRYIPAIECSGEHPDSQSCPYGGTATPESPPLPSPNQPIEGKRGSKKRDIFTFRKHS
Download sequence
Identical sequences E7FE32
ENSDARP00000095052 ENSDARP00000122393 ENSDARP00000114150 NP_001006076.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]