SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7FF26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7FF26
Domain Number 1 Region: 323-448
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.12e-29
Family PLC-like (P variant) 0.062
Further Details:      
 
Domain Number 2 Region: 750-878
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.16e-27
Family Synaptotagmin-like (S variant) 0.0037
Further Details:      
 
Domain Number 3 Region: 475-611
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.21e-21
Family PLC-like (P variant) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7FF26
Sequence length 888
Comment (tr|E7FF26|E7FF26_DANRE) Extended synaptotagmin-like protein 2a {ECO:0000313|Ensembl:ENSDARP00000025094} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=esyt2a OC=Cyprinidae; Danio.
Sequence
MSASVNGVEPKPAPAVSQNGPGSPPQTPKDVTPPELELPDEEPQSSVTEATQMGIKFAKT
FLLIFPIYLLGYLEFSFSWVLIGLGLVFWLKRNQGSRFARVNQAMAFLEQEERAVRQTIR
SSELPPWVHFPDVERVEWLNKTVQQMWPYICQFVEKIFKETIEPAVQGANTHLSTFTFSK
IDMGDKPLRVDGVKVYTENVDKRQIIMDLQINFVGNTEIDVDIKKYYCRAGIKSIQLNGV
LRVIMEPLLGDMPLVGALSVFFLKKPFLDINWTGLTNMLDIPGVNSLCDNVIQDIINGCL
VNPNKITIPLADDALISKLRFPMPRGILRVHFLEGQDLLSKDTYMGGLIKGKSDPYGVIQ
INNQLFRSKIIKDSLNPRWNEVYEAIVYDGQGQVVFIELFDEDTDHDDFLGSLTMEIDEI
QKQQKVDEWFDLIGVPNGKLHVKAEWLSLHPTPDKLDEVLSSIKADKGQANDGLSSALLL
VHLDSAKNLPRNPLEFNSAGLKKGAVNKAVKSGKKVTSVPNPFVQFTVGHRSFESKTRFK
TIEPVWEETFTFLIHNPKCQDLEVEVKDEKHECSLGTITLPLSQLLKEKQMTMSQRFPLK
NSGPGSTLKMKMALRILSLDKLAASDKPSSAQVHRAGSVRKTSNATPQRPAVSEPAKTSK
TQQPAPAPRTQPTPTPSPRVEPVTDRKPLEESPPHLAKSGKSMSNLAISGSNLHLNSKEQ
TPSIASDISNLAATQELQKTIQHLHNGASPGFAPLGEIELTIRHSPQRNKLIVVVHKCRN
LISASQNGSDPYVRLYLLPDKRRSGRRKTSTAKKTVNPVFDQTFEFTVSIVELQKRTLDV
AVKNGGGILAKHRGLLGKVIVEFNLEDPSKSSTQWYELSVDGFKRPSP
Download sequence
Identical sequences E7FF26
XP_698532.4.45394 ENSDARP00000025094 ENSDARP00000025094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]