SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7FFB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7FFB4
Domain Number 1 Region: 303-412
Classification Level Classification E-value
Superfamily ARID-like 3.79e-34
Family ARID domain 0.00032
Further Details:      
 
Domain Number 2 Region: 598-670
Classification Level Classification E-value
Superfamily Chromo domain-like 1.3e-17
Family Chromo barrel domain 0.015
Further Details:      
 
Domain Number 3 Region: 59-113
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000373
Family Tudor domain 0.014
Further Details:      
 
Weak hits

Sequence:  E7FFB4
Domain Number - Region: 534-573
Classification Level Classification E-value
Superfamily ARM repeat 0.0115
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7FFB4
Sequence length 671
Comment (tr|E7FFB4|E7FFB4_DANRE) AT-rich interactive domain 4A (RBP1-like) {ECO:0000313|Ensembl:ENSDARP00000094005} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=arid4a OC=Cyprinidae; Danio.
Sequence
MKVADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRMVKVKVVLKGDSTSQVVQDDQVKGPL
RVGSTVEVKSPEGGLSEAVISKLTDASWYTVVFDDGDEKTLRRTSLCLKGERHFAESETL
DQLPLTNPEHFGTPVIGKKTNRGRRSSQAVAEDEKESSSSEDDDDDKRRLNDDLLGKVAC
VQSEPDDSWLCVLVISPSCNDDLTVKKDQCLVRSFADSKFHTVARKDVKEVNIDTLSKPE
YSLRKGCEAAKLFLQNRQIPDRWKVDLSEILESSSSDEDDEDEDGEGKEGEEEEKEPEPE
EPDDEPDPEERDHFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVHIHGGCDNIES
GSIWKQIYMDLGIPVLNSAASYNVKTAYRKYLYGFEEYCRSAQIQFRTVHHNEPRPDVQP
EVQSIKSVTKESENNDEMMQQVTAEPGTSEDKPAADADESDAESEKGRKDVCSPRGRRRC
LTTPVKVEMEPLKQEKIKEEKKKEDTQSVGENSGEEPKEKSDGEIPGKRRSRRHEESDKD
SEEDDDDNDDEEQDDDDEDDEEEEEDDDDEEEDYFERSRLRERDEREEGDGCEDSEHSLA
GTKVRVKYGKGKTQKIYEANIKNTETDDGEVLYLVHYYGWNVRYDEWVKADRIIWPVDKG
GTKKKQKKKVK
Download sequence
Identical sequences E7FFB4
ENSDARP00000094005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]