SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7FGH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7FGH2
Domain Number 1 Region: 634-757
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.06e-30
Family PLC-like (P variant) 0.029
Further Details:      
 
Domain Number 2 Region: 312-434
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-28
Family PLC-like (P variant) 0.0083
Further Details:      
 
Domain Number 3 Region: 951-1076
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.99e-27
Family Synaptotagmin-like (S variant) 0.0025
Further Details:      
 
Domain Number 4 Region: 466-592
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-24
Family Synaptotagmin-like (S variant) 0.035
Further Details:      
 
Domain Number 5 Region: 787-891
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.13e-19
Family Synaptotagmin-like (S variant) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7FGH2
Sequence length 1079
Comment (tr|E7FGH2|E7FGH2_DANRE) Extended synaptotagmin-like protein 1a {ECO:0000313|Ensembl:ENSDARP00000028904} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=esyt1a OC=Cyprinidae; Danio.
Sequence
MQKSPMSVDDAGPNAGAAPEAADAAPTTDSAGKHAVSVLWSFGKCVGAFLPVYLAGYFGF
SISVVLLGLLVYIGWKHSRDGKKARLQSAMYFLENEQDVTTTRVFRSKRDLPAWVNFPDV
EKVEWINKILQQAWPFVGQYLEKLLVETIAPSIRATSAHLQTLSFTKVDLGDRAMKVVGV
KAYTEFDRRQVILDLYISYAGDVEINVEVKKYFCKAGVKGIQLHGKLRVILEPLIGDVPL
VGAITMFFIRRPKLDINWTGMTNLLDIPGLNAMSDTMIMDAIASFLVLPNRLTVPLVANL
HVAQLRSPLPRGIVRIHLLEAENLPAKDNYMKGVISGKSDPYAVLRVGTQIFTSHHVDNN
LNPQWREMYEVIVHEVPGQELELEVFDKDPDQDDFLGRMKLDLGIVKKAVLLDEWYTLKD
AASGQVHLRLEWLSLLPSAERLSEVLERNQNITVPSKTADPPSAAVLTVYLDRAQDLPFK
KGNKDPSPMVQISVQDTTKESRTVYGTNNPAWEDAFTFFIQDPRKQDIDIQVKDDDRALT
LGSLYIPMSRLLSSPELTMDQWFQLEKSGPASRIYITAMLRVLWLNEDAILTSPVSPIPG
EGYGETEVSSGATKVTATPKRPEHTSPDSNFASEGVLRIHLVEAQSLVAKDNLMGGMMKG
KSDPYVKIRVGGLAFKSQVIKENLNPVWNELYEVILTQLPGQEVEFDLFDKDIDQDDFLG
RVKVSLRDLISAQFTDQWYTLNDVKTGRIHLVLEWVPKISDPIRLEQILQYNYRQSYLNK
IVPSAALLFVYIERAHGLPLKKSGKEPKAGAEVSLKNVSYRTKVVNRSTSPQWDEALHFL
IHNPTEDTLIVKVSHSWGQALGSLVLPVRELLEEKDLTIDRWFSLNGAMPESQILLRAEL
KLLDSKLAQCSDEEDASHVIPSAEPTVAANSELRHRNVPVQGGEDASSTGKAQIKLSISY
SSEEHRLIIKVHACRNLPSSSKEPPDSYISFILLPDKNRNTKKKTSVKKKSLKPEFNEIF
EFDMSLEEAKQKHLEVSVKNSVSFMSREKELLGKLQIDFSPLDLKTGVSQWYDLSHETN
Download sequence
Identical sequences E7FGH2
ENSDARP00000028904 ENSDARP00000028904 XP_695611.3.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]