SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7KK59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7KK59
Domain Number 1 Region: 91-187
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.14e-22
Family Thioltransferase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7KK59
Sequence length 203
Comment (tr|E7KK59|E7KK59_YEASL) Grx7p {ECO:0000313|EMBL:EGA84041.1} KW=Complete proteome; Reference proteome OX=764098 OS=Saccharomyces cerevisiae (strain Lalvin QA23) (Baker's yeast). GN=QA23_0171 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MAIVINKRNVRVLVITNLLLIVVFFVLRNSNASVNESITTHHPDSLVTFDNSGNAPGTHQ
SVHDTVNTQDKEAEEVDKNSGDAEFDAAAEYNKIMEQSPMIVFSKTGCPYSKKLKALLTN
SYTFSPSYHVVELDRHEHTKELQDQIEKVTGRRTVPNVIIGGTSRGGYTEIAELHKNDEL
LDSFKKWSDGAFTVKANSQSESA
Download sequence
Identical sequences A0A0L8VV86 A6ZKW0 C8Z408 E7K9Q1 E7KK59 E7LR50 E7QBD2 H0GC90
YBR014C YBR014C YBR014C YBR014C YBR014C YBR014C tr|A6ZKW0|A6ZKW0_YEAS7 YBR014C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]