SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7KSZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7KSZ6
Domain Number 1 Region: 30-101
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000144
Family TBP-associated factors, TAFs 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7KSZ6
Sequence length 157
Comment (tr|E7KSZ6|E7KSZ6_YEASL) Taf9p {ECO:0000313|EMBL:EGA81323.1} KW=Complete proteome; Reference proteome OX=764098 OS=Saccharomyces cerevisiae (strain Lalvin QA23) (Baker's yeast). GN=QA23_3811 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MNGGGKNVLNKNSVGSVSEVGPDSTQEETPRDVRLLHLLLASQSIHQYEDQVPLQLMDFA
HRYTQGVLKDALVYNDYAGSGNSAGSGLGVEDIRLAIAARTQYQFKPTAPKELMLQLAAE
RNKKALPQVMGTWGVRLPPEKYCLTAKEWDLEDPKSM
Download sequence
Identical sequences A0A0L8VJJ5 A0A250WEV9 A6ZMU9 B3LMC5 C7GRB5 C8ZFA1 E7KGY2 E7KSZ6 E7LYX6 E7NLS3 E7Q858 E7QIL8 G2WKU4 H0GLD9 N1NZ24 Q05027
tr|A6ZMU9|A6ZMU9_YEAS7 YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W NP_013963.1.97178 YMR236W YMR236W YMR236W YMR236W 4932.YMR236W YMR236W YMR236W YMR236W SCRT_02131 YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W APC7026 YT72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]