SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7LRS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7LRS1
Domain Number 1 Region: 165-293
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.68e-18
Family UBX domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7LRS1
Sequence length 436
Comment (tr|E7LRS1|E7LRS1_YEASV) Ubx7p {ECO:0000313|EMBL:EGA79835.1} KW=Complete proteome; Reference proteome OX=764099 OS=Saccharomyces cerevisiae (strain VIN 13) (Baker's yeast). GN=VIN13_0406 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MLEALFRDSVEEAINDSIKQGVVLAVYNTARDDQWLKSWFKGDDVSLDTLAEHSIWLRLV
KDTEQFQLFEQVFPNVVVPSIYLIRAGKIELIIQGEDDRHWEKLLTCIGIKDKKAGESSS
RETNPGLAREEKSSRDVHRKNARERIAETTLEIQRREQLKQRKLAEEERERIIRLVRADR
AERKALDETHHRTLDDDKPLDVHDYIKDAQKLHSSKCVLQIRMTDGKTLKHEFNSSETLN
DVRKWVDLNRTDGDCPYSFHRGIPRVTFKDSDELKTLETLELTPRSALLLKPLETQNSGL
SVTGMEGPSLLGRLYKGFSTWWRNDKDPEVTSQREETSKPNRHEVRSSTPLSGAASSSCF
QYNNVREPVQSSAHASPMLTPSGTRYPSETNLTTSRSVSPNVFQFVNNDHQEDPEDPTTF
NGNNVHLEKKKDEDKE
Download sequence
Identical sequences A0A0L8VUU8 A6ZLL2 C7GMV8 D3UF21 E7K9L9 E7KKN8 E7LRS1 E7Q167
YBR273C YBR273C YBR273C YBR273C tr|A6ZLL2|A6ZLL2_YEAS7 YBR273C YBR273C YBR273C YBR273C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]