SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7NER8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7NER8
Domain Number 1 Region: 122-281
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.86e-52
Family Glutathione peroxidase-like 0.000000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7NER8
Sequence length 301
Comment (tr|E7NER8|E7NER8_YEASO) Sco2p {ECO:0000313|EMBL:EGA63390.1} KW=Complete proteome; Reference proteome OX=764101 OS=Saccharomyces cerevisiae (strain FostersO) (Baker's yeast). GN=FOSTERSO_0179 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MLNSSRKYACRSLFRQANVSIKGLFYNGGAYRRGFSTGCCLRSDNKESPSARQPLDRLQL
GDEINEPEPIRTRFFQFSRWKATIALLLLSGGTYAYLSRKRRLLETEKEADANRAYGSVA
LGGPFNLTDFNGKPFTEENLKGKFSILYFGFSHCPDICPEELDRLTYWISELDDKDHIKI
QPLFISCDPARDTPDVLKEYLSDFHPAIIGLTGTYDQVKSVCKKYKVYFSTPRDVKPNQD
YLVDHSIFFYLIDPEGQFIDALGRNYDEQSGLEKIREQIQAYVPKEERERRSKKWYSFIF
N
Download sequence
Identical sequences A0A0L8VV77 A6ZKX0 B5VDZ4 C7GM28 C8Z418 E7KK63 E7LR56 E7NER8 P38072
YBR024W YBR024W YBR024W YBR024W YT154 tr|A6ZKX0|A6ZKX0_YEAS7 YBR024W YBR024W YBR024W 4932.YBR024W YBR024W NP_009580.1.97178 YBR024W YBR024W YBR024W YBR024W YBR024W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]