SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7NKL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7NKL5
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.63e-35
Family Thioltransferase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7NKL5
Sequence length 103
Comment (tr|E7NKL5|E7NKL5_YEASO) Thioredoxin {ECO:0000256|PIRNR:PIRNR000077} KW=Complete proteome; Reference proteome OX=764101 OS=Saccharomyces cerevisiae (strain FostersO) (Baker's yeast). GN=FOSTERSO_3086 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQHPQADFYKLDVDEL
GDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA
Download sequence
Identical sequences E7NKL5
YLR043C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]