SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7NPL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7NPL1
Domain Number 1 Region: 116-263
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.43e-35
Family Dual specificity phosphatase-like 0.00000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7NPL1
Sequence length 281
Comment (tr|E7NPL1|E7NPL1_YEASO) Siw14p {ECO:0000313|EMBL:EGA59920.1} KW=Complete proteome; Reference proteome OX=764101 OS=Saccharomyces cerevisiae (strain FostersO) (Baker's yeast). GN=FOSTERSO_5185 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MGLYQAKNDEGSDPKSSSKIDDLIENEAEIIRLIKEDGKLLIDNGDGRDIHNIIQEDKLL
SVEFNEVLKRFHGEEKSDIPRKEFDEDEDDRYDSNEHHQKTIEVMNTLNHVINKEVIPPE
NFSHVVGEIYRSSFPRQENFSFLHERLKLKSILVLIPEEYPQENLNFLKLTGIKLYQVGM
SGNKEPFVNIPSHLLTKALEIVLNPANQPILIHCNRGKHRTGCLIGCIRKLQNWSLTMIF
DEYRRFAFPKARALDQQFIEMYDDDEIKRIASKNNWLPLQW
Download sequence
Identical sequences A0A0L8VIS7 A0A250WH41 A6ZS58 B3LPQ4 C7GWP9 C8ZFK9 E7KHC6 E7NPL1 E7Q8Q1 G2WL39 H0GMR0
YNL032W YNL032W YNL032W SCRT_03159 tr|A6ZS58|A6ZS58_YEAS7 YNL032W YNL032W YNL032W YNL032W YNL032W YNL032W YNL032W YNL032W YNL032W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]