SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7Q3X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7Q3X6
Domain Number 1 Region: 93-177
Classification Level Classification E-value
Superfamily HSC20 (HSCB), C-terminal oligomerisation domain 4.97e-19
Family HSC20 (HSCB), C-terminal oligomerisation domain 0.0073
Further Details:      
 
Domain Number 2 Region: 29-81
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000000017
Family Chaperone J-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7Q3X6
Sequence length 184
Comment (tr|E7Q3X6|E7Q3X6_YEASB) Jac1p {ECO:0000313|EMBL:EGA58673.1} KW=Complete proteome; Reference proteome OX=764102 OS=Saccharomyces cerevisiae (strain FostersB) (Baker's yeast). GN=FOSTERSB_1738 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MLKYLVQRRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSS
TLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDD
EAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQL
EMNH
Download sequence
Identical sequences A0A250WC13 E7Q3X6 G2WE75 N1P9S9 P53193
YGL018C YGL018C YGL018C YGL018C YGL018C NP_011497.1.97178 YGL018C 4932.YGL018C APC90051 JAC1_YEAST YGL018C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]