SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7QHH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7QHH2
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.83e-41
Family YKR049C-like 0.000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7QHH2
Sequence length 133
Comment (tr|E7QHH2|E7QHH2_YEASZ) Fmp46p {ECO:0000313|EMBL:EGA86012.1} KW=Complete proteome; Reference proteome OX=764100 OS=Saccharomyces cerevisiae (strain Zymaflore VL3) (Baker's yeast). GN=VL3_2993 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSFWKTLQRQPRTISLFTNDIASNIKSQKCLQLLKGDVSHRFDVEIANRFPTWDQLQYMR
TSCPQGPVSLQRQIPKLDSVLKYKHTDPTFGMDLQKCVQRGLWNPKEALWVDWENKLVGN
EPADIDKYIIQRK
Download sequence
Identical sequences A0A0L8VLN6 A0A250WJB8 A7A009 B3LRC8 C7GNL6 E7KF55 E7NK70 E7Q6F7 E7QHH2 G2WI77 N1P2Q0 P36141
YKR049C SCRT_04065 YKR049C YKR049C YKR049C YKR049C YKR049C APC6384 YTYst250 tr|A7A009|A7A009_YEAS7 YKR049C YKR049C 1wpiA 000011356|e1wpiA1|2485.1.1.15|A:1-133 cath|current|1wpiA00/1-133 d1wpia1 1wpi_A YKR049C YKR049C YKR049C YKR049C YKR049C YKR049C 4932.YKR049C NP_012975.3.97178 YKR049C YKR049C YKR049C YKR049C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]