SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7QIM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7QIM9
Domain Number 1 Region: 190-347
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.0082
Further Details:      
 
Domain Number 2 Region: 29-82,147-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000112
Family Glutathione S-transferase (GST), N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7QIM9
Sequence length 366
Comment (tr|E7QIM9|E7QIM9_YEASZ) Gto3p {ECO:0000313|EMBL:EGA85487.1} KW=Complete proteome; Reference proteome OX=764100 OS=Saccharomyces cerevisiae (strain Zymaflore VL3) (Baker's yeast). GN=VL3_3835 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSEKSASNNKAEFKRQSSPFREIISADHPIYKPAKGRYWLYVALPCPWAQRTLITRALKG
LAPIIGCSVAHWHLDDKGWRFLEEGDGKTNERHWFDIAGGISSVNLNTSTPVANIPNNAH
RLLVDGTDEPHYGYKRLSDFYFKTKPDYKGRFTVPVLWDLETCTIVNNESSDIIRIMNSA
AFDEFVGEEYRQVRLVPRSLEAQITEFNSWVYDKINNGVYKAGFAECAEVYEREVTSLFQ
YLDKLENLLDKKYTDLEAEYGKNNKDKILDRYFAIGDTLTEADVRLYPTIVRFDVVYHQH
FKCNLATIRDDYSRIHTWLKNIYWRHEAFQRTTDFTHIKLGYTRSQPRVNPIGITPLGPK
PDIRPP
Download sequence
Identical sequences A0A0L8VJ89 A6ZMW6 B3LMD9 B5VQ19 C7GRA1 C8ZFB6 E7LYY7 E7QIM9 H0GLF1
YMR251W YMR251W YMR251W YMR251W YMR251W YMR251W YMR251W YMR251W SCRT_02146 tr|A6ZMW6|A6ZMW6_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]