SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E7SNL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7SNL0
Domain Number 1 Region: 29-147
Classification Level Classification E-value
Superfamily PapD-like 3.66e-37
Family Pilus chaperone 0.0000379
Further Details:      
 
Domain Number 2 Region: 155-242
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 1.11e-22
Family Periplasmic chaperone C-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7SNL0
Sequence length 250
Comment (tr|E7SNL0|E7SNL0_SHIDY) Periplasmic fimbrial chaperone StfD {ECO:0000313|EMBL:EFW48905.1} KW=Complete proteome OX=941429 OS=Shigella dysenteriae CDC 74-1112. GN=SDB_03763 OC=Enterobacteriaceae; Shigella.
Sequence
MFNLTNTAKIVVPALALLATAVSFSSHASVTPDRTRLVFNESDKSISVTLRNNDPTLPYL
AQSWIEDAKGNKISSPLAVLPPVQRIDAMMNGQVKVQGLPDINKLPADRESVFYFNVREI
PPKSNKPNTLQIALQTRIKLFWRPKALENTSMKSPWQHKVTLIRNGQDFTVNNPTPYYVI
ISNASAKKGGNPPAGFTPLMMEPKTSAPLNAKMDSVPVLTYINDYGARMPLYFKCTGNSC
QVDEEQSRKG
Download sequence
Identical sequences A0A2K0PZN9 E7SNL0 E7THC7 I6CJY4 I6DXU5 K0XC12 Q31YC0
gi|82544819|ref|YP_408766.1| WP_000482749.1.100116 WP_000482749.1.100447 WP_000482749.1.11296 WP_000482749.1.13867 WP_000482749.1.18225 WP_000482749.1.20907 WP_000482749.1.2325 WP_000482749.1.27426 WP_000482749.1.28046 WP_000482749.1.29230 WP_000482749.1.35039 WP_000482749.1.44840 WP_000482749.1.45538 WP_000482749.1.65056 WP_000482749.1.68067 WP_000482749.1.68271 WP_000482749.1.9185 300268.SBO_2375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]