SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E8R8P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8R8P6
Domain Number 1 Region: 90-245
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 9.56e-21
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0071
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000211
Family Ferredoxin reductase FAD-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E8R8P6
Sequence length 255
Comment (tr|E8R8P6|E8R8P6_DESM0) Dihydroorotate dehydrogenase, electron transfer subunit, iron-sulfur cluster binding domain protein {ECO:0000313|EMBL:ADV64872.1} KW=Complete proteome OX=765177 OS=O7/1). GN=Desmu_0563 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MYTPAKVVSTERLSSSMYMKKVKLLDGDTVEPKPFQFILIWVPGVDLLPMSVAGFTSGEI
TLVVRERGEGTRKLLHYDGFLGVSGFHGKGFEPWGYRRILFVAGGSGIAPFFHLAEKAWE
KDIVVDVVWGVREAGELFNPARLLGKPRGDVYVATEDCRVGYCGRASHLASRLVAGNPGK
WDAVIASGPIGLLREACGSLGGFLDVYVNLEAYVKCGVGACGSCVLKPHGLLLCRHGPVF
KCSEVEEFLKGGTGA
Download sequence
Identical sequences E8R8P6
gi|320100762|ref|YP_004176354.1| WP_013562094.1.43297 WP_013562094.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]