SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E8RAD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8RAD1
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily Ribose/Galactose isomerase RpiB/AlsB 3.01e-39
Family Ribose/Galactose isomerase RpiB/AlsB 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E8RAD1
Sequence length 150
Comment (tr|E8RAD1|E8RAD1_DESM0) Ribose-5-phosphate isomerase {ECO:0000313|EMBL:ADV64341.1} KW=Complete proteome OX=765177 OS=O7/1). GN=Desmu_0022 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MRVAVGSDDTYSVAGFIAEYLRRKGFEVKLVGALATGKPYPWPDVGFEVGSMVARGEVDY
GVVICYTGTGVSIAANKVKGVRAALVTDARNAEGARKWNDANVLALSARLTSEELAKEII
DAFFAVREVDPSEAENIRKLKAVDTLGDTR
Download sequence
Identical sequences E8RAD1
WP_013561563.1.43297 WP_013561563.1.60640 gi|320100231|ref|YP_004175823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]