SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E8RAM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8RAM0
Domain Number 1 Region: 133-211
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-21
Family Translational machinery components 0.0016
Further Details:      
 
Domain Number 2 Region: 49-120
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.39e-19
Family Ribosomal S5 protein, N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E8RAM0
Sequence length 214
Comment (tr|E8RAM0|E8RAM0_DESM0) 30S ribosomal protein S5 {ECO:0000256|HAMAP-Rule:MF_01307} KW=Complete proteome OX=765177 OS=O7/1). GN=Desmu_1159 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MSASAVDKAALEKWVPRTRVGRMVLEGKLTSLKEVFDKNLPILEPEIIDYLLPNLKYERI
DTKIVQKMTDAGRRTKFLVVVVVGNEDGFVGVGTGKAKQYVDALAKALRNAKLNITPVRR
GCGSWECRCGEPHSVPFTVRGKSGSVEVVLKPAPRGTGLVAGDVAKVVLRLAGIRDAWTE
SFGETRTTLNFAKAVANALHNTYRFVTPVEWLRT
Download sequence
Identical sequences E8RAM0
gi|320101346|ref|YP_004176938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]