SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9EZ54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9EZ54
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.06e-19
Family Regulator of G-protein signaling, RGS 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9EZ54
Sequence length 269
Comment (tr|E9EZ54|E9EZ54_METRA) Protein phosphatase 2A, regulatory B subunit, B56 {ECO:0000313|EMBL:EFY99245.1} KW=Complete proteome; Reference proteome OX=655844 OS=anisopliae (strain ARSEF 23)). GN=MAA_05303 OC=Metarhizium.
Sequence
MATRPPTLTEILLDVSPPPWTLSAFMAYLSQNHCMETLEFTLDSQRYAAFYDQLAAENPP
SQESNARVCGLWDKLMEVYIVPCAPREVNIPARVRDRLLSLPSGPAAPHPAELEEAGRII
YELMNDSLLVPFLQSVAPLHFMGQNDDSSHHHHQQRRRSQNTAQHPDQPRRSVASPHSAD
FDSLTDDSDSNSPSGPEPMTPPTTPPTSEYTFNSSPGGFQRAMAAHNKGWKKVGEKLGFS
RKASSRRSTPTSSSSDYDAALGEPSHGHP
Download sequence
Identical sequences A0A0D9PB67 E9EZ54
XP_007821492.1.8330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]