SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FQV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FQV8
Domain Number 1 Region: 1-278
Classification Level Classification E-value
Superfamily C-type lectin-like 4.71e-91
Family Sulfatase-modifying factor-like 0.00000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9FQV8
Sequence length 286
Comment (tr|E9FQV8|E9FQV8_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX90057.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_94253 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MVMVRGGIYEIGTDEPVFIADGESPARSVYLDDYFIDTHEVSNQDFADFVEISNFVTEAE
KFGSSFVFEGILSDETKSEISKVVASAPWWMPVVNASWKFPEGPNSSISDKMNHPAIHIS
WNDAVSFCDFYGKRLPSEAEWEVACQGGLKQRLYPWGNKLNPYGKHWTNIWQGKFPGENT
AEDGYVGTAPVDAFPPNKYGLYQMVGNVWEWTMDWWQVDHSSELLRNPMGPKKGKDKVKK
GGSYMCHQSTCFRYRCAARSQNTPDSSSSNLGFRCAMSSSPQVKIL
Download sequence
Identical sequences E9FQV8
jgi|Dappu1|94253|fgenesh1_pg.C_scaffold_1000364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]