SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FR71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FR71
Domain Number 1 Region: 222-260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9FR71
Sequence length 615
Comment (tr|E9FR71|E9FR71_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX90112.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_309932 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MAPIILGLTIMLFLGCSVQSGKTEAAVDVIHSLTHQIAPVNAVHWPAILGDDRSHRTGNI
DGRLERSLFGSSSSSSSTSTTSTGGCLEQSEISENTIIRTKDSRALGAKFLNETSLGADA
RDRCLNLCCSFHGCNVAVYEEKDGGNCYLFDCGPAEDFRCKFTSHSHYTSGVIRRRENAH
EEELTQLKKVVVTEVTTTAQPVATVPITNPPTTTTPPSTAKPVRTCSRYQFECHTTRECI
AIYNACDGIAQCSDGSDEAPELGCPATTTETPTTRTLVTTQPVINAKNSPVDIQQNSVIA
QHPPLDWRGSRGRDRYSERDQVASVELPPNPDVNHWRTGQENTRNYERAHPPYQTGISGE
AIPYSVEPDRSANSYYNPDIRHYGSTWTERQDRPISNVNDYRAVDNTYYYEKDARPSYDA
SSNVYPSRKHDWERNNAVIVNSSPPQHSFLAVPVESRPIQPIAPIVVDNSRPVIVESTGQ
LVQKVPAIPEQKIVKTPELTTVAPVVAVETTTIAQPKITIPAKSKSLSLITKPEIVANHA
HIHHFSVNQADFQEEKAERSRQTVGAAWALTLGLSVTAVLVLLVGCRLRSLKRHLRRGRG
GHTRDADYLVNGMYL
Download sequence
Identical sequences E9FR71
jgi|Dappu1|309932|NCBI_GNO_0100465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]