SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FRD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FRD7
Domain Number 1 Region: 4-82
Classification Level Classification E-value
Superfamily HMG-box 1.15e-31
Family HMG-box 0.0000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9FRD7
Sequence length 84
Comment (tr|E9FRD7|E9FRD7_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX90214.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_39527 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
KKNNPNHIKRPMNAFMVWSQIERRKICEIQPDMHNAEISKRLGKRWKTLSEEERQPYIAE
AERLRQLHMQEYPDYKYRPRKKAK
Download sequence
Identical sequences E9FRD7
jgi|Dappu1|39527|e_gw1.1.1015.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]