SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FRW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FRW3
Domain Number 1 Region: 16-259,331-377
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.97e-93
Family Type II chitinase 0.00000197
Further Details:      
 
Domain Number 2 Region: 259-330
Classification Level Classification E-value
Superfamily Chitinase insertion domain 2.09e-18
Family Chitinase insertion domain 0.00072
Further Details:      
 
Weak hits

Sequence:  E9FRW3
Domain Number - Region: 419-460
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00173
Family Tachycitin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9FRW3
Sequence length 500
Comment (tr|E9FRW3|E9FRW3_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX90411.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_39671 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MDRGLFDNKSHSDFFGGYCTWAVYRPGNGKFDVEDIDTNLCTHIIYGFTGLGTDNTIQCL
DPWNDLYDGGGKGALYRFTGLKSKKPSMKALVAIGGWNEGSEKYSVMVSDPAKRAVFVNS
VVNFIKKFNFDGLDFDWEYPANRGGIPSDKQNFVSMIQELRNAFAPYGWLLTAAVSPGKS
TIDSAYDIPAVASNLDQVHVMTYDYHGAWDPYTGLNSPLFSNNLVDKGTDNILNANWTIN
YWISNGVPRSKIIFGMPLYGRGFVLDNPSVNGFYAPAALPIPDGPYTRQNGTWGYNEICE
KFKYEAGWTVVRDSCYMSPYAVKGNLWIGYDDQQSLRAKGQMIAAMNLGGALIWDMDTDD
FRGLCHGTTFILTKTVIDAMNGPTNLMPTPSYPCRTDTTLTTTSVSTTTATPPSTKKKMV
YYCKREGYNADPDDCGVFHQCVYYTETGWQDFVQPCAPGTGKFALRIIIIKNMTIIGHYF
KFFFKNFTIHYFFTKYFSIQ
Download sequence
Identical sequences E9FRW3
jgi|Dappu1|39671|e_gw1.1.586.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]