SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FSH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FSH1
Domain Number 1 Region: 21-262,333-395
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.01e-94
Family Type II chitinase 0.00000321
Further Details:      
 
Domain Number 2 Region: 254-324
Classification Level Classification E-value
Superfamily Chitinase insertion domain 4.43e-18
Family Chitinase insertion domain 0.00057
Further Details:      
 
Domain Number 3 Region: 396-452
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 5.49e-16
Family Tachycitin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9FSH1
Sequence length 453
Comment (tr|E9FSH1|E9FSH1_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX89831.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_310112 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MKIVVLLALSLLVTLANAQGNYKKVCYFANWAVYRNGLGQYGPDKLDAFECTHLIYGFSV
LDRVTYEMKIFDDWADIGLGGYRTFTGLKNQNPNLKTLIALGGWNDSAFSTQYSELVADP
VKMANFVQKALAFVLQYNFDGLDFDWEYPGDPGKPEDKENFITLLRMLRDAFKPHNLLLT
IAVSCSAVRAETSYNIPALAEAVDFVNLMTYDIHGAWENQVDHHAPLYRLAESVDFWLEN
GMPAEKLIFGLPAYGRSWKLEDPTQTGLLSPATGAGPLGQFTGQDGFLSLYEMCSYQQSG
WTTVTDPSGKMGPYSFKGTTWASWDDVDMAIRKVKYAMSKNLGGIMFWELSLDDFLGFCN
MGPRPFSNAITATLEGRPFDTSTPAPTPTLYPITTQRPIKCTSNGQYYADPADCSKYYQC
VNEQVITLYCQAGLVFNSKVNVCDWPYNVPGCY
Download sequence
Identical sequences E9FSH1
jgi|Dappu1|310112|NCBI_GNO_0200044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]