SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FTU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FTU4
Domain Number 1 Region: 94-146
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000288
Family Tachycitin 0.017
Further Details:      
 
Domain Number 2 Region: 281-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000562
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  E9FTU4
Domain Number - Region: 717-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000885
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 186-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0179
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9FTU4
Sequence length 1075
Comment (tr|E9FTU4|E9FTU4_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX89581.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_310490 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MEPIKCIVIFVLLSVSVLAVPRSAIDLNERVERAIHSGDPSSGLKTASKPASYKSNQETS
ITLAPKIVSTSILMEKEPIVAIPLSNQCDPARPHSPHPTDCYKFYHCVNRPNGVQQVEKT
CNPPTMFNPDTMICDWPESVMRIRPECGLSNVTTQVPVLPPTLSSSAALEKAQIKPVPIK
SVPLKAICTPPCQNLGFCKAPNVCICPEIFEGPQCQFTKSKPCVEKPPTPKNSRIVCNST
ACTSTCNTGFTFPGGSKEIQMVCDSGNWVQLQQPQGTVQKVADCQPVCDPVCENGGRCLP
NNVCLCPEEFRGPQCKYPLKNCAPERLNFNGGYNCSIGSTLYRCTLKCGVNGVFEFPPAP
FYTCDFAKAKFTPEPIPKCISESQFAKNLKSKPTSAPQILIEQNSELKGNFQQSSNLESE
WYHPTTINPNTASTLKEASKTSSRSICPTSKIREIEHQVRFRCNCGEDASLPLKQLPELT
TTEKVVTTLRPVTTEKVGNIVTTTTPATSKKIAESCPKGYTWSRCAYICTRCLVALFCFI
LVLPLYAAPQGQPEESDELVDYGEYQQDERPKGENYVLQYVGPRQKAERLFKVMALSKGT
SWGVRQSDEQNLKMNQTQGLSKDNGNAFANLSDEGSAVVSTELKTPRNKSALISFKGGCM
EKPPKPANTAANMKCAPNNGHCDVKCVKNFFFPDKLKQLRIHCEAPGIWKVGDSEKIPDC
EPICMPPCQNFGFCSAPDICTCSENFEGPQCQFAKDNLCHDKPPTSMNSQVVCNGTSECI
STCNKGFAFASGNTELKWTCDTGHWPHVTHLVKTEEGAWLTTFVSVPKGSGDRNAIIVGA
FDFSRVKIEHCLVVSTFFVTQFCLYNLSCCPIETFTAVENCAPERMGFNGVYNCSCGSSS
LSCCVLCSLNCGTDGVFEFPPAPVYSCEYAEAKFFPETVPQCIFGKYWNEDLWLIAKLKI
AWESIAENQEQQEQPVQSFKSNSTSHSQMVITQTSNMEWTGKETSNQETDFSVVSNGFQG
FLGFIPKNRILNSEKDNYKATRDLLGKSMPSRVNYGSNLYQKKYHSNKSAPPYKN
Download sequence
Identical sequences E9FTU4
jgi|Dappu1|310490|NCBI_GNO_0200429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]