SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FUL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FUL0
Domain Number 1 Region: 165-224
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 1.96e-18
Family Tachycitin 0.003
Further Details:      
 
Domain Number 2 Region: 102-164
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000154
Family Tachycitin 0.027
Further Details:      
 
Domain Number 3 Region: 40-100
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000152
Family Tachycitin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9FUL0
Sequence length 228
Comment (tr|E9FUL0|E9FUL0_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX88749.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_300583 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MKSTIKSTILLALLVSHGLQFISAARLRVEARDIDLGESDFQCPDGLYVAPHETQCNLYY
ICGAGSTPTHLYQCRDDLLFDLQYYGCNYKEQVDCGDRVPFACPSPNGNFPVKEAACDSN
YYVCTNGVAMKESCPDGGIFDASLSSCAAPGIIICPTTTTVTPRITPGPFECPESNGYFS
SPYSCSQFYICQDGTPILNDCPAGLYYNALLNICDWPYSVDCKIPNAF
Download sequence
Identical sequences E9FUL0
jgi|Dappu1|300583|PASA_GEN_102100001 jgi|Dappu1|311086|NCBI_GNO_0300439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]