SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FUP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FUP5
Domain Number 1 Region: 162-222
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 6.02e-19
Family Tachycitin 0.004
Further Details:      
 
Domain Number 2 Region: 40-98
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000112
Family Tachycitin 0.049
Further Details:      
 
Domain Number 3 Region: 102-151
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000471
Family Tachycitin 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9FUP5
Sequence length 225
Comment (tr|E9FUP5|E9FUP5_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX88888.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_220992 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MNSKVLASLVAFCGLMAIVAGASNSKLQIEARDTDLGESDYQCPEGLYVAPHETQCELYY
ICASGGTPTHLYQCRDDLLFDLEYYGCNFKEMVDCGDLLAPFTCPSPNGKFPVKEGACDS
RYYICTDGVSDLQTCPNGGIFDATASSCVATPCATTTTVAVPTAPGPFECPAPNGYFPSP
YSCSQYYVCLEDKPYLYTCPAGLYYNPALEACDWPANVNCNLPGF
Download sequence
Identical sequences E9FUP5
jgi|Dappu1|220992|estExt_fgenesh1_pg.C_30523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]