SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FUP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FUP6
Domain Number 1 Region: 263-326
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000523
Family Tachycitin 0.038
Further Details:      
 
Domain Number 2 Region: 169-233
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000288
Family Tachycitin 0.021
Further Details:      
 
Domain Number 3 Region: 105-172
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000186
Family Tachycitin 0.033
Further Details:      
 
Domain Number 4 Region: 31-95
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000107
Family Tachycitin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9FUP6
Sequence length 344
Comment (tr|E9FUP6|E9FUP6_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX88766.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_220993 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MLKSLISVFLLQSFLLEISAFSLSSMKQERFTCPASDGFYAIDGQCTADYYACVDGVAYP
QICPGTNNVFDPLISKCVPYESASCRTGATTSPATTITSTSRTTMTPTGPTFTCPTLEGF
YAIPDTCGPDFYVCVSGSPYIATCPEGSIFDPATLVCTAIDQASCQSEFKCPTSDGFYPV
PGTCGNSYYSCVGGTAYLQNCPGTAVFDPATNNCVMEENASCKSTTTTTRTTPTTTPTTT
PTTTPTTTPTTTTTTTTTTPKPTTPAPFVCPGPAGQYPYPDSCTLYYVCSSGGNYIVASC
PVGQVFDPSTQYCEDPVNVPGCQFDPILFLRDLRFVGITGSPLV
Download sequence
Identical sequences E9FUP6
jgi|Dappu1|220993|estExt_fgenesh1_pg.C_30524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]