SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FVS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9FVS2
Domain Number - Region: 44-62
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.034
Family Tachycitin 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9FVS2
Sequence length 66
Comment (tr|E9FVS2|E9FVS2_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX89056.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_310844 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MQLHIILKFAIIFVLLTSSIGGSNTMRLPDRHSNSLNAIGVLGLSKCGNGQKFNSKLNRC
MNVWSG
Download sequence
Identical sequences E9FVS2
jgi|Dappu1|310844|NCBI_GNO_0300195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]