SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FXP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FXP2
Domain Number 1 Region: 224-288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.11e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 109-177
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-17
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 62-120
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000983
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 167-235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000222
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9FXP2
Sequence length 293
Comment (tr|E9FXP2|E9FXP2_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX88249.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_234882 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MYQDKVSLHMNHWILFSESCYFGGVPCNSQQHMCNHQCYEFRFGVNGVGGGCRYWPFATQ
PLKSSYGFGETIQFSCRLGYVLEDPQMSALTCADDGQWDEQEIPVCEPIRCSDVQVPKHG
TVSGTSSILDSRITFSCQEGYQLNGEEQITCRPDGTWSHPAVCVTRSCGDPPNIDNGFAV
VRGPGVGDPISYSYQTGHRLSVVESRTCLSNGRWSGEDPACDPVVCAVPEAPGHGSWTVG
GFVPGSTIRFQCKPGFTLVGSATVTCLTDKSWSDRPPSCQQITCRPLRDVSGQ
Download sequence
Identical sequences E9FXP2
jgi|Dappu1|234882|SNAP_00002940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]