SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FYB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9FYB8
Domain Number 1 Region: 1005-1262,1334-1386
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.03e-98
Family Type II chitinase 0.00000148
Further Details:      
 
Domain Number 2 Region: 490-748,820-861
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.4e-95
Family Type II chitinase 0.00000331
Further Details:      
 
Domain Number 3 Region: 748-819
Classification Level Classification E-value
Superfamily Chitinase insertion domain 9.62e-22
Family Chitinase insertion domain 0.00039
Further Details:      
 
Domain Number 4 Region: 1254-1325
Classification Level Classification E-value
Superfamily Chitinase insertion domain 1.98e-19
Family Chitinase insertion domain 0.00048
Further Details:      
 
Domain Number 5 Region: 373-425
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000115
Family Tachycitin 0.011
Further Details:      
 
Domain Number 6 Region: 897-948
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000418
Family Tachycitin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9FYB8
Sequence length 1388
Comment (tr|E9FYB8|E9FYB8_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX87504.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_235148 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MSESQKYLDKKKKKPAAAATVARSRDWVGRDSSLFNWKITSRQGKRRNNAEKEKTVEDLD
TSRFVAPHRSISSAKPPSVHHNLASFSLSFDCFRRTIKTPKMPLYTYRPILSASCKCEED
VVLHLCAENTPATSVDQRFVLPIDPYRSARNNAQFTTLHLNSSTPSIARRRNQGLQTSFP
LEFEFKNSKQMIRTDPKRALSACRRFQREQENQTVACAEVIKVVDSQGHMIQFHVSRVAM
TANSLRVLALLAGLVVALPVVENLAVKRQVVQPAAERSGSFYRGAVESPPQIIQAGLGFQ
RSSVEYRPNPDFRPRNPLALKNFNSGVFLSQFYFPSLQVDHYRQQFPAYAPFVLPTYVDN
LVIQKDITVKESCTNGQGLRPNPSDCSGYQMCNHGEWVSMSCADGLYWNAELAICDWPAN
VRCALPESSQPAPQPSSTTAAPEPSVVTSAAPASPEPSVTSAATASPEPSTTSSAPAAPS
TTFAPETAATPSPPSSSGPAKVICYYTNWSWYRQGEAKYAPADIDLKLCTHILYGFATLD
PNKGIMQVFDSWSDTDEYGPSLYAKVVALKKHGIKVLIALGGWNDSAGGKYSVMVNNPAS
RRRFIENAMIFIENYGFDGLDLDWEYPKCWQVDCNAGPASDKPAFAAFVKELREAFNPKG
WLLTAAVSPSKAVIDAGYDIPSLSRDLDWIGVMTYDYHGHWDKKTGHVAPLGFHSEADVA
YFNTEYTLNYWIRGGADPGKVIMGIPLYGQSFTLENPSNNGLNAPAKGTGSAGEFTRQAG
FLAYYEICKTIANGGWNVVHDEEGKLGPYAYRGDQWVSFDDVNMVRKKSEIAKAMKIGGA
MIWALDLDDFRNKCGCETYPLLKTINRVLRNYPASSAKCDIKSVPGVFQTTALAKSACQE
NSYKPHESDCTSYYHCVFGQWSAHTCPNGLFWNKEYCDWPYNTQCGDGSQTYVPSVPSPT
ATPSAPVAPSETSTASGAYVEWKPSTTTAKPTPSPFPEVTLPDTGFKVICYFTNWAGYRT
GEGKYKPEDIDPAMCTHIIYGFATLSPSELTMRVFDSWADTDEYGPNLYAKVTALKKNGI
KVLIALGGWNDSLGSKYSQLVNNPTARKRFVDNAVAFVEKYGFDGLDLDWEYPKCWQVDC
KAGPDSDKPAFTAWVRELSEAFKPRGWLLSSAVSPSKTVIDLGYEVAALSPYFDWIGVMT
YDYFGNWDKTTGHVAPLYAHSEVENKYFNTNFTLNYWIELGADPSKIILGMPMYGQSFTL
EDPTSNGLNAKSKGPGEAGEFTRQGGFLAFYEICHRMKQGGWTVVQDPEGAMGPYAYKGN
QWTSFDDVAVIRRKSELVKSMNIGGAMIWALDLDDFSNRCGCERYPLLRTINRVLRNYPT
PDPNCNYA
Download sequence
Identical sequences E9FYB8
jgi|Dappu1|235148|SNAP_00003206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]