SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FZB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9FZB7
Domain Number - Region: 211-307
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000395
Family C1 set domains (antibody constant domain-like) 0.062
Further Details:      
 
Domain Number - Region: 37-85
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0224
Family Hairpin loop containing domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9FZB7
Sequence length 312
Comment (tr|E9FZB7|E9FZB7_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX87290.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_97249 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MSSMSILFGITLLSLMHLVDAENSTDWNIGDGGFKWRTNCDFPGDDIGQIPLTTATREEC
GRLCISNPQCSHFVFGYLENCYMKKAPSTTPRQDIDYESTAICGFIPWRLGSETGNDDWK
SINISGIENCGFYGNGSLILTAECRQAKDCSYWYQQVLSTNGSTACKLADGSLGSCCPQV
PKIPQLNPFNLPGFPKETQYIRMIPDGSERIIDAGTTLTLTCVYAFEDENQRNTFNFSWE
IPDYLSKNAELSDLDTRLRKTFGRNETHMTSTLSLANARARDTGNFGCKGLPIGFPNTFT
VNQYVYVFSSFN
Download sequence
Identical sequences E9FZB7
jgi|Dappu1|97249|fgenesh1_pg.C_scaffold_6000316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]