SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9FZT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9FZT3
Domain Number - Region: 53-88
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000153
Family Pan module (APPLE domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9FZT3
Sequence length 108
Comment (tr|E9FZT3|E9FZT3_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX87207.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_236047 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MTVKALSFFLLMAALSMTAESARKWKEGDNGLVRWDLDCTFESSVHIASKDIPGDQCGRF
CLANKDCTHFTYKSGTCYLKRSTIHWQEEGEYLSACGFIPSRTSQKIN
Download sequence
Identical sequences E9FZT3
jgi|Dappu1|236047|SNAP_00004105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]