SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9G302 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9G302
Domain Number - Region: 534-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0628
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9G302
Sequence length 578
Comment (tr|E9G302|E9G302_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX86416.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_313153 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MTNCSVLFISTAIVIAIFGQTRAAVIPPEWADVRINPCAKASWQYLYWKSDGKCYPIFKQ
GYPCPATLELVFDSSTKEAKCQCPSGRLYWEEDGRCYEPFTPGPCPEGSFLHPGQEVQSR
GMQRQDPLRRTLHQVQAWLGQQYEPSKVEPLGFVHCKQRGYCPANWGFWSATELCYPFDS
QGPCQSGSLFRWNVVSQQAECGCQSAIIYQSSVKNDTLAGSSWRPYFWPISATCHEHHTN
GPCKLGEVFGYNQSAQATQCSCSKQLPSYHAESGQCFEKYTRGPCSVGMWLTSHPLDLPQ
YSMPASARPTQSSRLKGSKARKVYPNTQPVANNRRNSVKQSLSCYCLPGFVYSEEDDQCF
REYTQGPCRSGYFFIRSEEGDIRSYGICWKNPCARQELYLPESQRCYGIHTQGHCLDGQI
ILADDAHGIGYRGRCGCSTTNLQHYWPADGKCYAHETSGPCKGDLLFSLRSGDGLTPACT
CPEDYVSYNGTVQCFKPFSQGPCQWNEWLVPAAAASGVGTNDVSSVNDNRLDFEPYVCQC
KPGYEYQMGSTYCQPPSLELLFSLPKTKNGPSRRFKRE
Download sequence
Identical sequences E9G302
jgi|Dappu1|313153|NCBI_GNO_0800102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]