SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9G4Q9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9G4Q9
Domain Number 1 Region: 45-205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000316
Family Glycosyl hydrolases family 16 0.079
Further Details:      
 
Domain Number 2 Region: 367-417
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000107
Family Tachycitin 0.027
Further Details:      
 
Weak hits

Sequence:  E9G4Q9
Domain Number - Region: 168-353
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0968
Family Phase 1 flagellin 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9G4Q9
Sequence length 452
Comment (tr|E9G4Q9|E9G4Q9_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX85344.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_98890 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MRHSSSLLISIGILLGLFGRSSVIVNSQTCADKGEGKGFAYLSSGLDNNFENGGLQPWIE
ESTTSVQWEIEDYFSPWETTNPSPQPLNGQTYLRVHRGPTLSFGIAVLRSPTFTLLPNEN
SVFSFSFWIRSKWPQFTNLELYLAENGNEKLLSSLYNYSDITNLEWRTHSVTLIGDSPST
LSLAFYAYCGTNVEDAVAIDDIAFTLSQQSTTISFSVTDSTTEEITTTVIPNTDTPTTTP
PEITFTSSTSTTPTPTKTSTTTPITTPTAPITTPTTTPTTTPTTTPTTTPTKTSTTTPIT
TPTAPITTPTTTPTTTPTTTPTTTPITTLMATPPTTPTTEFTTIPSTESPTSPTTMTYDT
TTIANLFTCPDNIDFKYPDPNNPCSRKYYHCENCVATEQECPQKQIFYNQTQSCRPCVQA
LNSGSKSLKGKTTDGVENDHRSVTTVCKADYI
Download sequence
Identical sequences E9G4Q9
jgi|Dappu1|98890|fgenesh1_pg.C_scaffold_10000313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]