SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9G8R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9G8R9
Domain Number 1 Region: 33-93
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000418
Family Tachycitin 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9G8R9
Sequence length 94
Comment (tr|E9G8R9|E9G8R9_DAPPU) Putative peritrophic matrix protein PTM1 {ECO:0000313|EMBL:EFX84020.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_315109 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MKSTSLPLVFLAVLIAVSLPGSTAVPVGTCPSVDGPNPVYLTDSVRCDVFYECSNGYANE
KVCPNNPYANPPANLHWNKALSVCDFPQNANCLL
Download sequence
Identical sequences E9G8R9
jgi|Dappu1|315109|NCBI_GNO_1300171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]