SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9G990 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9G990
Domain Number 1 Region: 21-266,340-381
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.75e-87
Family Type II chitinase 0.00000304
Further Details:      
 
Domain Number 2 Region: 258-330
Classification Level Classification E-value
Superfamily Chitinase insertion domain 7.33e-16
Family Chitinase insertion domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9G990
Sequence length 383
Comment (tr|E9G990|E9G990_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX84099.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_315267 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MRLLLLATLFVCGVVPFASAGRFVCYFPNWAIQRQDPWQFGVDNIDTRLCTHLVYSFADL
DDSTLQIKSSKPVVDIVQKGYRKFTGLKSQNPSLKTMLAFGGWGDSNINDKYSRMVSTSE
NIQTFVDSALRMLTDYGFDGLDVDWEFPRTEADKIGFSNLLAALKKAFAPYNYVLSAAVP
ALPADLGYDIPSIEASVDFINLMTYDMHGPWEPETADHHAPLRKRSWETADNNIEYSIDY
WTENGLSANKINLGMPLYGHSWKLSSDVTAPPAPASGGGAPGPFTGEEGILSYFEICLAV
QNEGWQVVQDPDQLNGPYALSNTDVVNWIGFDDIAMVTTKSNFILSRGLGGAMVWEISLD
DFRGSCGAGVNPLLTAISRIVVA
Download sequence
Identical sequences E9G990
jgi|Dappu1|315267|NCBI_GNO_1300330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]