SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GBC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GBC6
Domain Number 1 Region: 49-113
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000068
Family Antifungal peptide scarabaecin 0.058
Further Details:      
 
Weak hits

Sequence:  E9GBC6
Domain Number - Region: 145-212
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0275
Family C-terminal domain of PLC-beta 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9GBC6
Sequence length 313
Comment (tr|E9GBC6|E9GBC6_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX83181.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_100809 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MGRTSSAGHQQFLFGLLALGVLSWSVNPALGAVRRPPNYHHDHMPETSFTCAGKVVGGYY
ADPDADCQMFHVCVQVDENDVRDFKFMCPNDTVFDQENFICANWFEIDCRSSTFFYDKNL
QLFQPNVESNKTGSGTSSLSAGTEEPSEQQKRQQEQQLKQLMVLEEQQAAQVLKQQQVID
QHERRQQEHQRNQLKIIQDQQKQQEKQQGRKVTTSASPVAARSIGVSTTTATPYVEEKGE
ESVIEYDYYYYDYDDSLEHGNFYANDDYDPKAPGRIIDPTNARPPLLPIVPPSTSVASKT
TTPLEPTNKSHKL
Download sequence
Identical sequences E9GBC6
jgi|Dappu1|100809|fgenesh1_pg.C_scaffold_16000054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]