SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GDK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GDK5
Domain Number 1 Region: 215-277
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000262
Family Antifungal peptide scarabaecin 0.075
Further Details:      
 
Domain Number 2 Region: 159-215
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000115
Family Antifungal peptide scarabaecin 0.052
Further Details:      
 
Domain Number 3 Region: 283-346
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000102
Family Antifungal peptide scarabaecin 0.069
Further Details:      
 
Domain Number 4 Region: 43-93
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000131
Family Antifungal peptide scarabaecin 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9GDK5
Sequence length 388
Comment (tr|E9GDK5|E9GDK5_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX82097.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_316647 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MKAVYVCPGKSLFDGQRCVEPDVYTCPYSSPDCQLGGGAATVSNGYQADLNSGCRNYYFC
SGDGHKLITLTCSDGRLFDGKKCVDPDQYRCPLSSDLMTTTERPKVTAGSVHLDSYYSYP
SAGSARKPSGSASHPQTYFVSSRNSATPTITGRPASSSAKDYCEKNYGFFVVQGTGCRNY
YICIGGSRSDLQCSGETVFNGQVCVDPAQYTCPESSHKSDCQGKSDGVYPDRQSGCRNYY
LCLGQVQTDLSCPAGQLFDGRRCADSRRVTCSDPVATEGRTHSVQSPCAGRTNGLYLDHN
YPGCRGYLYCRSGRPYGPAGRCTRSERFSGQHSRCLPKHEVECRLPTDDNEDDEEDYMMA
EASAMLVTVIADDFVTTTTTTAAAPTSN
Download sequence
Identical sequences E9GDK5
jgi|Dappu1|316647|NCBI_GNO_1800067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]