SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GE37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GE37
Domain Number 1 Region: 122-170
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000123
Family Tachycitin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9GE37
Sequence length 179
Comment (tr|E9GE37|E9GE37_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX82202.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_241371 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MVLRPATLCCFLLLVALATSAKIPSKNMHRQSSIEENREKNARSAKLEELMMKDKKIPSQ
EVSIVNMSGSGEDPDDDYWEDPIEELDEMHPVVTTTTEPPQPPTTETVTTTIPANENQLS
GSCKSLANGNYLNPFDCKTFIYCFNGIAYILNCPTTLISGVQWNWCDITREAQNLPPCN
Download sequence
Identical sequences E9GE37
jgi|Dappu1|241371|SNAP_00009429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]