SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GE65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9GE65
Domain Number - Region: 103-156
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000608
Family Pan module (APPLE domain) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9GE65
Sequence length 206
Comment (tr|E9GE65|E9GE65_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX82213.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_241398 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MLNKELMPLCLLAIAVLLVSTEASPKAIFDSRHVVAKQEKTPGYTDKRVIDPRCATCSHD
CPPSCGPYTTPHPVTEPPCHDCHDTCPPVHKPPTTKFPNLPSITYSTNCDFCDHDLYTLT
CVATPFECAARCAVDLRCSHFTYIANHQGGTCVLKKAFGSGGAWASSIPSPSPYVCGYIP
SRALIGIFLNICVGLDITGSIRTGTA
Download sequence
Identical sequences E9GE65
jgi|Dappu1|241398|SNAP_00009456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]